DPCstruct | MC39203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 186 ± 27 aa |
| Standard deviation of domain lengths | 26.62 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 23.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8RSU8 | 23-198 | EADTGAGVNGSGNTGNTDTTTQNESTSNEKTETNQSEKTFTQKDVDKLIQERVAREQAKWEKKVQDERTEAEKLAKMNADQKAEYEK… |
| A0A2V2DU51 | 23-154 | NKDYQAELDRRITKGIETARANWEKQALAREQEAVRLSQMTAEEKAREELQRERERADGLEREKNRIMMGQTAMNELQRRGLPVGFS… |
| A0A2D1KMK2 | 2-196 | None |
| A0A1M6RN49 | 9-212 | None |
| A0A2T4Z910 | 1-207 | None |
| A0A239AJ67 | 28-196 | None |
| V6IXE1 | 6-228 | None |
| A0A512PLF4 | 1-235 | None |
| A0A6G7WZK7 | 1-200 | None |
| A0A7X5EJ24 | 9-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.