DPCstruct | MC392
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 124 ± 15 aa |
| Standard deviation of domain lengths | 14.67 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I3SRF8 | 1-113 | MSPGAMDPADDPRKLAERCEIAFDGRRYLYRQYRYDRLDDALRYAQLDRQRPGFKPDPAFLPRWEAPLQPDAAQQALMAPAGIGFAD… |
| A0A6L6QCY0 | 95-208 | RKIMHNAPSTGECEESDESLAARFEISFDGKRYAFRQHHYDVFLDALRYATAEHAKAGFLRDDTFVPNWMAAYHPTDDDEGVMRLHG… |
| A0A0G3BGN5 | 2-103 | None |
| A0A4Q7XK48 | 25-151 | None |
| A0A848FDG8 | 36-179 | None |
| A0A521YV54 | 59-189 | None |
| A0A254TAH6 | 1-140 | None |
| A0A7S9C7X3 | 1-130 | None |
| A0A5B8NDG1 | 42-178 | None |
| A0A0Q7WKK0 | 10-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.