DPCstruct | MC39192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 144 ± 13 aa |
| Standard deviation of domain lengths | 12.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 17.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6Q6C6 | 1-120 | MRIITLVIGKKGAGKSKWILEKKDEMLSEGWKQIDAQKETDYNQAIFALKSPTGEVAILNSGSDLKCIIKEFGDFLVQHEEASRIFT… |
| A0A5L4NLS5 | 2-155 | MNFNALITLQGAANTGKTASISRAFLRTLEKKPLIRYFKYYEKGDFIAIVEFKDQYVSFCSAGDDLELVNKFELLNKEALEQGVKCF… |
| A0A653ZJA7 | 1-156 | None |
| U2JC97 | 1-138 | None |
| A0A8A9EYG6 | 24-174 | None |
| A0A2A4RN27 | 2-142 | None |
| A0A1Q6FI58 | 19-168 | None |
| A0A358R6W9 | 1-128 | None |
| A0A552V9H1 | 74-214 | None |
| A0A521MV54 | 32-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.