DPCstruct | MC3919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 172 ± 22 aa |
| Standard deviation of domain lengths | 21.81 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08157 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2SUQ1 | 23-194 | DDLKLVLESSDEEAPEEVTFEESKAQAVQSLKEAQDTARREKEQLREKRRKRQEFFQEQKKKKLLSADVLEKIASAPLKEQKHSEDE… |
| G3T5M0 | 50-251 | EDEEGDDEFDDEAPEELTFASAQAEAKEEERRVRETARRDKILLKEKRKRREELFIEQKKRKLLPDAILEKLTTASQISIKKSPGKL… |
| A0A6J3CIJ9 | 8-206 | None |
| A0A556TV75 | 5-179 | None |
| A0A671X1L9 | 1-184 | None |
| A0A0N8JYI3 | 7-158 | None |
| A0A667YTS4 | 55-189 | None |
| A0A3B4WAN4 | 20-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.