DPCstruct | MC39188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 307 |
|---|---|
| Mean domain length (aa) | 176 ± 35 aa |
| Standard deviation of domain lengths | 34.67 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 13.75 |
| Pfam Score | 66.71 |
| Assigned Pfam label(s) | CL0063- CL0747- PF00689- PF18096- CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A133UH39 | 8-164 | VLLTSRRGEEKYLLDDLENLGEFKTSEFRDVVIGWVEDKGSFLSELNSGTFPSMARVVPIEKTLEWSEESFEEDLSGAIRPYADRIE… |
| A0A7V6GVH6 | 2-156 | NCTATCSFGLESVLSAELKKMEFENIAAENGRVNFSSDLEGIAKANINLRTAERIYIELAVFNAVTFDQLFDNTERIPFHKYIDRYG… |
| A0A2A5P0B6 | 3-159 | None |
| Q4N3V1 | 78-311 | None |
| Q4N112 | 16-197 | None |
| A0A836DCQ8 | 56-253 | None |
| A0A5B8MYX7 | 163-335 | None |
| A0A7J6LE83 | 231-415 | None |
| A0A3B0NA21 | 21-261 | None |
| A0A146FM04 | 1-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.