DPCstruct | MC39187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 127 ± 4 aa |
| Standard deviation of domain lengths | 3.64 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 22.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F8LD53 | 1-125 | MELILAKILGIYFIAVSLALIFNPERIKRIYSEMLKSESLMFFGGIVAIFLGAWIVSVHNVWVLDWPVIITVVGWISLIKGVGLISC… |
| A0A1B1AIW1 | 49-172 | ATRFCARVIGPYYIVMAITLLTRQHTFELLLPTFMQNAPLVLTAGAFTLIAGLVLFTGHHHWSSPAAIAVSLTGILAALKGASLMAA… |
| A0A1F6R6Y9 | 60-182 | None |
| A0A378JUC1 | 7-140 | None |
| Q0AS80 | 25-150 | None |
| A0A3D9FGR0 | 8-137 | None |
| A0A2H0URU7 | 71-200 | None |
| A0A1G2JC30 | 23-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.