DPCstruct | MC39183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 88 ± 6 aa |
| Standard deviation of domain lengths | 5.70 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 30.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2K5R7 | 173-257 | RFVAEVLFPINQSGDQEGCTRHEDGSVTTPKGFKEAYKQYVESGWATLGNLPEHGGQGMPHVVSIAFQEYMISSNMAFAMYPGLT |
| A9I373 | 1-98 | MKTRIWIRLKPCSKNARFGEEAIAQLNVVGDTKPATWNAGEVTTSPGFKQTFRQYAEGGWQGLQHAPEFGGQGLPKTMGAACLGIFN… |
| A0A418X832 | 43-125 | None |
| A0A847Z996 | 27-125 | None |
| A3JEX1 | 42-127 | None |
| A0A6L5DFI1 | 141-225 | None |
| A0A6F8QCJ4 | 42-126 | None |
| A0A355H1W7 | 43-130 | None |
| A0A5A7NGN9 | 41-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.