DPCstruct | MC39181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 157 ± 13 aa |
| Standard deviation of domain lengths | 12.84 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0430 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I6LMA3 | 2-155 | SLYLLLKTLHILSSTVLFGTGLGSAYYSWRAWRSGRVEVIAATFRHLVFADWAFTATTAVIQPLSGLALVHLAGFDLRQPWLMWSMG… |
| A0A399I8N7 | 12-183 | GTAMQLQAHPMTRQILKCIHLTAVCTWIGGGLAVLVLLDNDRFTRNGDELFAFNHAIRSIDDCLIKPAAVISSASGLLLCLLINWRL… |
| A0A7V9HBP6 | 4-152 | None |
| A0A4R5BH14 | 103-267 | None |
| A0A3C1WFY4 | 4-145 | None |
| A0A6I3BQX2 | 30-207 | None |
| A0A3N5ESF6 | 4-176 | None |
| A0A7H5F3J0 | 1-155 | None |
| A0A2E0NSX8 | 4-168 | None |
| A0A843T575 | 2-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.