DPCstruct | MC3918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 307 ± 13 aa |
| Standard deviation of domain lengths | 12.75 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 73.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 36.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0515 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537XHD6 | 55-342 | GWVGPVFWPFAYYDIYDYAMWGYGFGAPFWGYGYPDIYAGIFAPYGYDDLSGYYYSPRRAPRGRNTAIDRLAQLCGDDSSEIAGLPI… |
| A0A537QBG0 | 55-367 | GGGWWRHRHGGFGWVGPLFWPLAYYDIYDYTLWGYGYDPLFWDYGYQDIYAGVFAPYGYEDQLAYLPSGGGGYAAGSRATVGRARAS… |
| A0A1I7LFE4 | 136-436 | None |
| A0A537QB50 | 416-714 | None |
| A0A537SSB1 | 261-564 | None |
| Q1QP41 | 1-304 | None |
| A0A109BEI3 | 29-364 | None |
| A0A537UCX7 | 1-309 | None |
| F8J915 | 196-512 | None |
| A0A537NJR0 | 133-426 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.