DPCstruct | MC39175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 320 |
|---|---|
| Mean domain length (aa) | 205 ± 50 aa |
| Standard deviation of domain lengths | 49.75 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 25.53 |
| Pfam Score | 94.73 |
| Assigned Pfam label(s) | PF14363- PF05832- PF11905- CL0293- CL0208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2VD95 | 10-231 | SLTIFFFHGAHSATFTFTNNCPYTVWPGTLTGQGPQLSSTGFELASKASSTLNVPAPWSGRIWGRTQCADTSGKFQCATADCGSGQI… |
| A0A6J0LKN8 | 2-151 | GTCETGSCGSTLKCSASGKPPASLAEFTLAALDFYDVSLVDGFNLPISVTPMNGKGNCSVAGCVADLRQKCPPELAVKSKGKVVSCR… |
| A0A803QM26 | 14-228 | None |
| A0A6V7PVV6 | 18-225 | None |
| I1CHU3 | 560-795 | None |
| A0A834T6R8 | 14-234 | None |
| A0A834SVC7 | 19-231 | None |
| A0A6A6L5P2 | 4-186 | None |
| A0A6A6L4P7 | 26-152 | None |
| A0A6A6KTZ8 | 22-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.