DPCstruct | MC3917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 8 aa |
| Standard deviation of domain lengths | 8.05 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A840R042 | 8-114 | VSHGEGQQHPIGLYFKVWILLFVLSSMSYAVDYFHFVGYLRWTLILVFMFLKAGLIITVFMHFAWEPSTLKLALGLPVIAIVVFIGF… |
| A0A537XA60 | 20-122 | ASHTKGQQHPIKLYLVVWGWLFVLSTCSYLVDYFGLHGHLRWSLILLFMVLKAGLIVAVFMHMAWERLALAYAILLPPVLVLVFVAI… |
| A0A1Z9TCG5 | 3-104 | None |
| A0A536YWM5 | 24-133 | None |
| A0A6N9CZY7 | 3-108 | None |
| A0A1Q7J264 | 2-99 | None |
| A0A4Q4XC60 | 389-486 | None |
| A0A2W5N371 | 20-129 | None |
| F6GBQ0 | 205-305 | None |
| A0A7C2VCU9 | 24-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.