DPCstruct | MC39168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 461 |
|---|---|
| Mean domain length (aa) | 114 ± 21 aa |
| Standard deviation of domain lengths | 20.96 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.77 |
| Pfam Score | 95.26 |
| Assigned Pfam label(s) | CL0179- PF02889- CL0036- CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1K485 | 4-106 | SGKAASSGEVTAVARVITSLDKISSFGPGEILVTVATCPMWTPVIAAAGGVVTETGGALCHAAIVSREYGIPAVVALKDATKKIRDG… |
| A0A1B8WUC7 | 123-270 | RGVLALPPGRKLTTITEGTAKGPIVGGNLTILASLVGTPYALDGTGCILVLEDTGESSYRIDRMMNQLWQSGLLSRVSAIVYGDFTA… |
| A0A1Q9CFJ4 | 956-1082 | None |
| A0A563VXQ6 | 86-206 | None |
| A0A5D2KYR5 | 591-708 | None |
| A0A497I6M5 | 8-115 | None |
| A0A3M1GSC3 | 40-160 | None |
| A0A5P2CUB4 | 7-114 | None |
| A0A3M1GNW8 | 10-126 | None |
| A0A6J7I7Q1 | 110-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.