DPCstruct | MC39166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 234 ± 30 aa |
| Standard deviation of domain lengths | 30.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N0I7U5 | 160-401 | VIDASEKRTVDLEFGAIGWQSKEGKIKVLHVYEDALDIVPCDFYPSASSKSGLVFYVDQLNPHRYIDLSKYFDIIADEKKAELLDIA… |
| A0A415TE97 | 26-267 | HFLEQPYNERKLIVPVQSYTDLSQKKLAVVDINNLPAINFPMGHPVANQLYVGHPYIPSKYIPFENYELELIEDKIREFSQIMQYLG… |
| J5VNV1 | 264-496 | None |
| A0A6C0HGQ2 | 78-339 | None |
| A0A197BYT3 | 77-250 | None |
| A0A0S9RC46 | 17-215 | None |
| A0A354SNS0 | 76-311 | None |
| A0A223N2N7 | 157-399 | None |
| A0A5C6X528 | 28-222 | None |
| W1SDW6 | 85-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.