DPCstruct | MC39165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 382 |
|---|---|
| Mean domain length (aa) | 161 ± 21 aa |
| Standard deviation of domain lengths | 20.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.68 |
| Pfam Score | 99.01 |
| Assigned Pfam label(s) | CL0505- CL0310- CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G0SID7 | 22-172 | AQSSPGFIADILAEMEYVQGQILQLAEAMPEDKYSWRPAEGVRSVGEVFMHIGVGDYFSLSYVGGSLPEGFGPDMDKSITKKEEIIN… |
| A0A848FNU4 | 1-133 | MKEQLLNLTDTSRKYTLDVAAAMPEGKYNFKPVDEVWNFRELLHHIAYGIEWWEANYVLGLETDWAPPATGKNKEEVMAYLEKAYDS… |
| A0A7W7ZEF1 | 2-172 | None |
| A0A2S6X1Z9 | 138-312 | None |
| A0A6L9IIB6 | 1-182 | None |
| A0A6L7YJ56 | 50-237 | None |
| A0A2Z3JUF3 | 130-290 | None |
| A0A7V2RX42 | 1-152 | None |
| A0A7V2PQB9 | 197-354 | None |
| A0A838RNB7 | 10-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.