DPCstruct | MC39161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 214 ± 49 aa |
| Standard deviation of domain lengths | 49.44 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 79.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11802 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q4I5M8 | 1-152 | MHKLCSELEMVASCYEAKRDKLKETRELYKKSKMLMHVHAFYRILQDIKEKIQKMKVYQESLMESLGYILEKHVPLPREDSSTNKKK… |
| A0A835NK61 | 25-215 | NPEIISTNPDILLELGKEELQKAKNDLEMVLSAVRSKNKKLEEDLKREQQWYEEQKQMLDTLNETGEDENTQVEQPSTKREFNDLKS… |
| F0ZND2 | 1-306 | None |
| A0A058ZCY0 | 157-447 | None |
| A0A077WMT7 | 83-299 | None |
| A0A6F9C8B2 | 42-214 | None |
| A0A2Z6RCV3 | 86-303 | None |
| A0A4Y8D635 | 2-182 | None |
| A0A1Y2GEI3 | 64-338 | None |
| L1JGA7 | 1-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.