DPCstruct | MC3916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 6.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G6WYU7 | 84-144 | GAPLEGANSFTEGQAQDRVLAAGYADVSTLTKDDKGIWRGTATKDGTTVKVAVDYKGNVVS |
| A0A4P8EHR2 | 13-84 | TAWAENTPEKGAPFEGANSFTEEQAIDRAVAWNVTEVSALTKDDQGIWRGTGMANGAAVSVAVDYKGNVVTS |
| A0A6M1MJW4 | 101-165 | None |
| A0A1M5PAE1 | 120-194 | None |
| A0A1H8XDL5 | 100-173 | None |
| A0A3S3YIS1 | 59-125 | None |
| A0A248UNW8 | 7-71 | None |
| A0A1Q3LAX1 | 1-60 | None |
| A0A6J4JR28 | 37-105 | None |
| A0A317F9L9 | 183-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.