DPCstruct | MC39156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 211 ± 34 aa |
| Standard deviation of domain lengths | 33.79 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2Y8H5 | 223-451 | AHWKKFLALGVAALAVVWVFAYIGVGHHENRQALSVLVGSLFWVSVLIGMLLLTMITRVFDAGWAPLVRRNWELLIEALPVVLLIGV… |
| B4DA29 | 7-188 | NRFEKWQRTAWIVGVVGCILWLIGIVVARHTAFQSYWFAWIFWNGIGFGALSILMLHILSGGAWGNVVRPTIRAAIFTIPMMAVLMI… |
| A0A536W0E9 | 12-207 | None |
| A0A2E5XCE5 | 274-564 | None |
| A0A832FU51 | 4-179 | None |
| D0JBN9 | 1-284 | None |
| I3TKM5 | 1-188 | None |
| A0A2V5VDU2 | 19-215 | None |
| A0A6M1Q9I2 | 15-225 | None |
| A0A2V5M0M6 | 2-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.