DPCstruct | MC39154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 116 ± 11 aa |
| Standard deviation of domain lengths | 11.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B4D5B4 | 33-150 | EVLAATLRPYTGESVHGVDTSTLTGKVMCGYQGWFNCEGDGANRGWVHWVKGRGIPSPSNIKVDLWPDVSELGADERFDTAFHHVDG… |
| A6DIB8 | 1-93 | MCGYQGWFTAKGDGSGSDWTHYKAGKELKPGSITIDLWPDMSEMDKDEKYPTPFKHADGSTAYLFSSYNGKTVDRHFGWMKDYKING… |
| B8PCA1 | 15-126 | None |
| A0A369JGD5 | 1-125 | None |
| A0A3R8KML6 | 153-271 | None |
| Q8A6U5 | 3-104 | None |
| B9XAT6 | 249-364 | None |
| A0A7X9XD23 | 18-130 | None |
| A0A7C5QLJ5 | 13-130 | None |
| A0A2E8S0I1 | 515-606 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.