DPCstruct | MC3915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 380 ± 13 aa |
| Standard deviation of domain lengths | 12.60 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 42.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K4C7U8 | 55-439 | TEIPLSYFKPKEIFTSIEKLKELGYTKDIYGNDLTNDNQIIELMPHDIVLPCSPESNDEKADEVFIKTSQFIDELLIRFYKLNKFYN… |
| A0A2E4KLE8 | 2-400 | SDVPATHFRPREIGVPWKTLHGLGYTHDYRGKPLNDDEQTLELFPQDFIVAKGAADFLLRTANYIDELLVRFYGMEPYYNADKSDDL… |
| A0A842TJ82 | 168-544 | None |
| A0A7J2YGL1 | 225-603 | None |
| A0A7J4JDE2 | 599-982 | None |
| A0A843CJC6 | 416-794 | None |
| A0A7C2VNE7 | 443-818 | None |
| A0A6V8CR45 | 567-967 | None |
| A0A842UID7 | 1-356 | None |
| A0A2U3CHF0 | 742-1109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.