DPCstruct | MC39147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Standard deviation of domain lengths | 13.01 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0136 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838NY19 | 12-125 | PERARGSANAKLLAAIDQLAFDEIPSNPGASKYRQGGTLGPEMKHWFRAKFGRGRFRLFFRFRTRERIIVYAWVNDGESLRMYDRRG… |
| A0A1W9UQS1 | 33-145 | PHNYMNHKKSKLLRRVYQSIIETVPQDPLHADFNLGKNTLGKHRQAWKRVKAGLPDRYRLFFKRSTGTQTIVYAWVNNEKCLRKDGA… |
| A0A6N9EQ17 | 10-105 | None |
| I4G2A3 | 91-214 | None |
| A0A7V9QEI2 | 54-164 | None |
| A0A1E4QGV9 | 2-88 | None |
| A0A2J7YIH1 | 2-95 | None |
| A0A1Y0EDD2 | 44-171 | None |
| A0A846HSR5 | 18-138 | None |
| A0A6L8GNV2 | 10-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.