DPCstruct | MC39145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 424 |
|---|---|
| Mean domain length (aa) | 351 ± 81 aa |
| Standard deviation of domain lengths | 80.87 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 14.83 |
| Pfam Score | 60.04 |
| Assigned Pfam label(s) | PF02397- CL0142- PF19896- PF15864- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838NS26 | 17-334 | MPIGVFFLARRYGRSLPAIDGFFRSVIAFGCALSAIALYNWYGFSSGAQLLGEELGPKDMLQLSFGRSNYLASILVLIIPTAIAFIR… |
| A0A7V9WP14 | 3-216 | KRLFALGIAGLCGLSVLFTLTRSVWLGAVVATIVAMLVAPRLRRYLPAVSLAAVMAVLGALLLVPGLLSLSQERAGNDRSVWDRSNS… |
| A0A356K385 | 15-504 | None |
| A0A371JGA3 | 214-678 | None |
| A0A558DAM5 | 11-434 | None |
| A0A3D8IPX0 | 26-487 | None |
| A0A5E8HB37 | 53-505 | None |
| A0A3S9KKJ3 | 9-473 | None |
| A0A7V2XSS9 | 48-484 | None |
| A0A1G0PED6 | 23-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.