DPCstruct | MC39144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 221 ± 36 aa |
| Standard deviation of domain lengths | 35.95 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0592 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N7Q858 | 11-231 | YYNREVKLNPEIVGLPWIKGYGFMPDLPIAISMDETLLNTVKEAVVEIDLTRLKERFEGIIFRWAGVENITAEELGISWAILSGNDR… |
| I4WE45 | 141-336 | DVIDLPEAKAFGNLPDLRQAMATDPVLVGMVQAYMDETVPAARDAMLEGLIFQWAGVTDVDPNSRDPRMIYGHVMDARQLLVLEQLI… |
| G2KPC4 | 53-260 | None |
| A0A2E2WK25 | 39-230 | None |
| A0A850EZX8 | 221-400 | None |
| A0A2T5R983 | 268-503 | None |
| A0A2S6HGB5 | 643-866 | None |
| A0A2V6TLI9 | 4-177 | None |
| A0A2M6VLR9 | 381-564 | None |
| A0A2A5H5D3 | 309-490 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.