DPCstruct | MC39140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 215 ± 37 aa |
| Standard deviation of domain lengths | 37.10 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 33.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7WZ65 | 185-380 | RISYAKVAEYQRRGLVHFHAVIRLDGATAEFIDQAIHAAARAVRLRTRRPDGTPFALVWGTQLDVRPIGDTDVTLASYIAKYATKGT… |
| A0A7X0IA43 | 9-206 | GPTDRPSDWAAVPVLQDAIRETAASVSVPIPDDGSSFVGRWGSQLDVDPIYVSTTLESVADQRVASYIAKYATKGAESAGTVDRRIR… |
| A0A7W7PY98 | 15-242 | None |
| A0A7W5ADD2 | 170-411 | None |
| A0A498PAW6 | 61-296 | None |
| A0A6G8FZP1 | 31-291 | None |
| A0A1V3XCF4 | 17-262 | None |
| A0A7W8END3 | 6-256 | None |
| A0A7I8A5K2 | 1-176 | None |
| A0A7K3E9B6 | 89-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.