DPCstruct | MC39139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 82 ± 13 aa |
| Standard deviation of domain lengths | 12.87 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N3KUP3 | 285-357 | KLYFLVKGSASKPYKVTFEKVGENNMNAFCSCTAGKKGRPCKHRYALIDGVVDDLVSGNEDEVAALAALIEGS |
| F8EWH5 | 1-83 | MEDALIFYIQGSAKSPYRIIAEGEGSSFKIFCSCPSCKRRGGKPCKHIFALLQGDITNLVSDNADEVYELRARSEGSTTLEVS |
| A0A851ISB5 | 5-88 | None |
| A0A2D5J854 | 2-83 | None |
| I6B2V8 | 7-79 | None |
| A0A0P7W794 | 2-73 | None |
| A0A7W6PS25 | 2-79 | None |
| A0A193LE36 | 29-102 | None |
| A0A5B0KIX0 | 13-84 | None |
| A0A0K0Y4L2 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.