DPCstruct | MC39138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 108 ± 19 aa |
| Standard deviation of domain lengths | 18.73 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0031 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A148KLY2 | 167-278 | AARLLPLEGGRNFRDLGGYATTDGRTVKWGKIYRSGVLAGLTEQDYQFIDELDIKTIVDFRANSERSSEVTKWHDSEVKVIQKDYEM… |
| A0A353EZ92 | 354-453 | YIDGVTNVRDIGGYASSLVEGGKIRQGLYYRGAKLDDITEAGKAELVRLGIRQEIDLRDEYQCKGPYVDGIRYTAVSIPSGTESRRF… |
| A0A359BBD7 | 1-160 | None |
| A0A1T4NXI3 | 212-311 | None |
| A0A2U1ZH11 | 13-111 | None |
| A0A515DH99 | 1-100 | None |
| A0A239B452 | 346-494 | None |
| A0A4R4V2V0 | 22-112 | None |
| A0A6L3F5H3 | 2-94 | None |
| A0A099P1J4 | 318-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.