DPCstruct | MC39135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 205 |
|---|---|
| Mean domain length (aa) | 97 ± 14 aa |
| Standard deviation of domain lengths | 14.47 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.47 |
| Pfam Score | 98.71 |
| Assigned Pfam label(s) | PF05495- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6DR26 | 3-108 | LRGVNVDAETRCAHWEDQVDVIALRFACCDTYYPCFSCHEAATDHEAVQWPADRFDELAVLCGACRTTLTAAAYLSSGDACPNCGAA… |
| A0A1X0T9X6 | 2-97 | ILGIQTDSCGRCVHYHNENDIAALQCAQCKQYYACFKCHDLMCDHTFVAMTTENSQPVMCGNCKTLLTYKQYQQYQCPFCQASFNPR… |
| A0A5E4EHR2 | 227-345 | None |
| A0A445IZW2 | 511-614 | None |
| A0A4S2MUW9 | 35-125 | None |
| A0A6P8I5B1 | 1-137 | None |
| A0A7S1XWB5 | 533-616 | None |
| A0A1R3KHQ5 | 113-189 | None |
| A0A2C9VYQ9 | 609-699 | None |
| A0A6S7GYD3 | 353-460 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.