DPCstruct | MC39132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 191 ± 29 aa |
| Standard deviation of domain lengths | 28.52 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 65.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 43.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C8ZEX4 | 1-154 | MKSSEEVKREPSTCEMTLEDFLTKAGAIDESSISPVMCLDVPGTPQYFSQQMGLSPAPSIGTLSDTPVVGRKRETLDITDRSIEKKM… |
| A0A2I4GW96 | 53-261 | MTVDGLLRTVYDSNPSTTESTLLDAQITVMETPTPVPSDSHPNGSSHAPKTVDEVWNEIVSGDRKECKVEAPDEMMTLEDFLAKAGA… |
| A0A6V7P1C4 | 3-185 | None |
| A0A059ABK4 | 5-183 | None |
| B9RPF8 | 46-237 | None |
| A0A5J5BRY9 | 1-164 | None |
| A0A3S3MNH4 | 1-250 | None |
| A0A830CDA8 | 1-181 | None |
| A0A1Q3BUC4 | 52-251 | None |
| A0A565CCB6 | 2-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.