DPCstruct | MC39131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 155 ± 29 aa |
| Standard deviation of domain lengths | 28.81 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 39.82 |
| Pfam Score | 86.81 |
| Assigned Pfam label(s) | CL0081- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830BB68 | 2-132 | WSVQCAECFKWRVIPTQEEYEQIRSKFIEDPFVCTKKSGISCDDPADINYDKSQTWVIDKPNVPKTPLGFKRRMVMRRDCSRMDCYY… |
| A0A835EF14 | 135-283 | KGVLEEDHTVKRQPYKRNQGFTTPIRLYAVECYTCHKWRTIPTKEEYEEIRENFTEDKWICNKRPDGSCDYPADMEYDRNGTWVVDK… |
| A0A6D2JR69 | 3-156 | None |
| A0A6D2I7N3 | 27-228 | None |
| I1I8M3 | 217-400 | None |
| A0A6J0PE50 | 1-165 | None |
| A0A6V7PF51 | 5-143 | None |
| A0A2G2WP18 | 50-166 | None |
| A9TNH5 | 43-216 | None |
| T1MEE4 | 25-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.