DPCstruct | MC39126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 109 ± 13 aa |
| Standard deviation of domain lengths | 13.31 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.67 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF14194- PF18842 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M5G007 | 1-120 | MDYRQYRRARKLVHACCNYDNGNCIMLDDGEACICVQSISYSLLCRWFRIAVLPLDNSLETALLYRGSMKRCTVCGQPFLPGSNRAK… |
| A0A2N0F3M3 | 3-108 | RKAIASFIESSCANYDEGSKCLLETDAQGGRQCPYFIEFPKRCKYAESHVLPAKPELLETDKPSETCQRCADPYQRKSNRQKYCESC… |
| D9R2T6 | 8-123 | None |
| A0A2A3A8H9 | 11-127 | None |
| G8U154 | 35-165 | None |
| V2YA11 | 71-165 | None |
| A0A396LZZ3 | 3-87 | None |
| F7JRC4 | 4-116 | None |
| A0A4R4FDV2 | 17-109 | None |
| A8RRJ1 | 83-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.