DPCstruct | MC39124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Standard deviation of domain lengths | 12.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15595 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A656WIE6 | 1-92 | MTLDVGGLAADVAVADAGHEPNGYFWEGLVRFAWPDIAEPLDFDSEAGMFCAVGTSSDLAQLKTALESVITSPDAVRDIIARAETSG… |
| A0A3N2M8M1 | 81-194 | KQEDPKNGIDELITPFFWVDNEDSASVCLYVGEYKDELFQTREDEGFEGNGYDWDSLAQVFLTELAPELKEVIDFDSEGSMFCAYSE… |
| A0A127R0R4 | 22-131 | None |
| F9EGY4 | 9-144 | None |
| A0A7W7L364 | 241-351 | None |
| D5SXA8 | 199-282 | None |
| R9KNH4 | 191-298 | None |
| A0A838RG03 | 175-265 | None |
| A0A7W9CP10 | 234-337 | None |
| A0A410XMU9 | 359-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.