DPCstruct | MC39123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 84 ± 4 aa |
| Standard deviation of domain lengths | 3.51 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4GR58 | 77-163 | GLALILRVLRDSGDVVDVMARQGAYQEMLGGKVFQLLRVWVDTALNIFPEMSANKYVIWVRFAAQDPELKPQPVTRDVAFKLARCNV |
| A0A2Z6IHH0 | 2-89 | QDSTDLILALLRDSCSWSGVEAPEGRYGALLDARHPPSLICLELSDRADYYPKISGGIHRFHIQWLPWLDQGTARAIESTIKFRLGLS |
| A0A447QPC0 | 1-78 | None |
| A0A090P4B6 | 21-102 | None |
| A0A7C3D2K5 | 200-288 | None |
| A0A6S6RUS6 | 54-135 | None |
| T1HA00 | 337-417 | None |
| A0A537D633 | 399-484 | None |
| A0A7C5GRR9 | 172-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.