DPCstruct | MC39120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2375 |
|---|---|
| Mean domain length (aa) | 181 ± 37 aa |
| Standard deviation of domain lengths | 36.81 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.38 |
| Mean intra-cluster sequence similarity (%) | 10.55 |
| Pfam Score | 22.26 |
| Assigned Pfam label(s) | CL0609- PF20127- PF12502- PF18443- PF14285 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A370H0Y2 | 1-127 | MPIAFETGGLQQLDPSTWGNPATGDLVTLAYVDAVPDLPVPLEDIDALRRRLTELQSEFGCLIEAHVLTVAGQPALLRLEKFPLPDR… |
| A0A7X6CPI2 | 31-206 | GAGIAIAIALGALTFQHFSKTPVENFLTYQSSEHQFAMKYPERWEKQELQNPLIADVLVFTAPKKNSADAYQEQMIVRIEDLPRPMS… |
| A0A5F2BNI7 | 12-152 | None |
| A0A3B0CBD1 | 21-161 | None |
| A0A6L5XRA3 | 211-399 | None |
| G8S338 | 831-1005 | None |
| A0A4R3YU57 | 2-193 | None |
| A0A1V4URE5 | 37-217 | None |
| A0A518I4G5 | 2-225 | None |
| E6N3U8 | 1-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.