DPCstruct | MC3912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 129 ± 13 aa |
| Standard deviation of domain lengths | 12.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12616 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H8QTE6 | 2-99 | LEISNWKVAQVVLMARELERAEAELRAFIDNLNEDEQASLVAVMWIGRESFTADDLEEAIETARAEATTPTADYLIGTPHLSDHLEN… |
| A0A3M1Q349 | 43-180 | MAGRRVEVVDDTESYPLNVPLSTVSYIIERIHEAIGELALEDSGVEDEDTAELPRGAETELAEVADFIDNLSEEERIDLVVLMWIGR… |
| A0A6N8XPT3 | 109-236 | None |
| A0A257PMI4 | 19-147 | None |
| W4HKY7 | 23-153 | None |
| A0A7C4ZJ16 | 4-112 | None |
| A0A537Q8G1 | 1-128 | None |
| A0A560KDC6 | 3-139 | None |
| H0A0E5 | 6-132 | None |
| A0A140J7L9 | 6-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.