DPCstruct | MC39106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 359 ± 70 aa |
| Standard deviation of domain lengths | 69.51 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02201 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W0E4B9 | 9-390 | DKYFSKLDNAFNKMALEKRLEIEAEHLKRIKTTKIIRFYTVKENKVLKVYAKVFNNLTGELKEDTIDFWELVKRVVIVDENAIIGDN… |
| M7B2L9 | 16-347 | QIRELVPESQAYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNPAKSDADDSDGSIASWELRVEGKLLDDISKQ… |
| A0A0V0QNB5 | 2-299 | None |
| A0A0C9YLK3 | 28-331 | None |
| A0A2V0PH61 | 19-343 | None |
| A0A665VGX1 | 47-403 | None |
| A0A1J8Q2M7 | 813-1249 | None |
| A0A7J6PKV8 | 98-485 | None |
| Q6FWT5 | 16-469 | None |
| Q4UB28 | 8-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.