DPCstruct | MC39105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 131 ± 13 aa |
| Standard deviation of domain lengths | 12.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.95 |
| Pfam Score | 72.62 |
| Assigned Pfam label(s) | CL0023- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A4AZV6 | 2-116 | DPIYKVFDAIMNFRKEEIDGLLKKIGVTLKHEDSDKDGKALLKVVMRSWLPAGEALLQMIAIHLPSPVVAQKYRMEMLYEGPQDDEA… |
| A0A1W0E2K7 | 19-153 | KIVDGQIPAGKKSPFEMFVLSPIFKVKDWCFEGKVNEIKEYLKKFGVDCSKLDLEGKQPGKQLFKATFKAWLPAAECLLEQIILKLP… |
| B7FNH1 | 36-163 | None |
| A0A1U7Y7E1 | 118-244 | None |
| A0A2H2J5S4 | 4-145 | None |
| T1H201 | 76-211 | None |
| A0A812M8P6 | 76-220 | None |
| A0A287XA67 | 369-493 | None |
| A0A1D1W4U3 | 7-140 | None |
| A0A822E5Y5 | 6-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.