DPCstruct | MC39104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 230 |
|---|---|
| Mean domain length (aa) | 121 ± 24 aa |
| Standard deviation of domain lengths | 24.23 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.72 |
| Pfam Score | 95.04 |
| Assigned Pfam label(s) | CL0451- CL0001- CL0079- CL0523 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7TVW3 | 20-148 | TVSISSISKSAGYHDVHEAIPRMHTRSAPQCEVVPVILNVSPPRRYAAICNSTQVLTFGCQGNCNSYVEMSKKDPQRALRSCRCCEP… |
| A0A0B2W467 | 108-185 | NREVFCTKEKFRRIHEDGGCRSVEAIKNALCSGWCGEGKECCTAVKGKRRRVKMHCNDGSTSVRTVHIVRKCECAAQK |
| A0A3Q0IQE1 | 37-147 | None |
| A0A553NI22 | 193-272 | None |
| A0A2C9K7G5 | 345-465 | None |
| A0A2C9K0B9 | 470-605 | None |
| A0A820KMI7 | 1-105 | None |
| T1EKQ0 | 3-106 | None |
| A0A6I9PXU7 | 10-113 | None |
| A0A165AFX6 | 364-481 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.