DPCstruct | MC3910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.66 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1K8K7 | 62-152 | EVHEEKTMSSFRYIQDPGHGWLEVPVSLLRELGIAEQITPYSYLNGNQAYLEEDKDMATFIRAMQTAGKPVEIVAVYQEATPIRGFP… |
| A0A836T220 | 4-86 | ISDQLTFIFDPGHGWLRVPLADIAALGIEGDISEYSFIDGRFAYLEEDCDYAVFAEACDAQNIPLPEIRDKYVERFARSRPRF |
| A0A0F9FAF3 | 1-74 | None |
| A0A518HY57 | 11-96 | None |
| A0A523D6P4 | 1-83 | None |
| A0A1G0KTR5 | 2-87 | None |
| A0A7C3YXV2 | 3-84 | None |
| A0A7V0WF46 | 1-82 | None |
| A0A0F9G9C7 | 2-88 | None |
| A0A497C1H0 | 98-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.