DPCstruct | MC391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 151 ± 17 aa |
| Standard deviation of domain lengths | 17.46 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.05 |
| Pfam Score | 82.22 |
| Assigned Pfam label(s) | PF20958- PF16216- PF20957 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151ALC8 | 299-437 | WTKAADNSAAFRINSSNTSFSYIKNPVMPKSLYVVSLDSMKSSEKTLISSLQGIVNGRSSSQIYTISYSHPDYKIWLEDLKNNYNVS… |
| A0A662GHR7 | 17-137 | RPEYLDIVDIRNMDFFNDFKFLPLITLQGLVNKHKPQIYIILRDEDELWLKLIRDENIPINKMDLNNVMEKYRDYCKGYIIYDPNVP… |
| A0A3B1BFD6 | 61-212 | None |
| A0A847JVE6 | 183-320 | None |
| A0A7C2L726 | 110-288 | None |
| A0A1B8VYP0 | 6-157 | None |
| A0A0Q9KV77 | 43-174 | None |
| A0A2E5CUW9 | 28-177 | None |
| A0A351MKN2 | 18-173 | None |
| A0A818C927 | 1-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.