DPCstruct | MC39098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 151 ± 28 aa |
| Standard deviation of domain lengths | 27.97 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 74.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 33.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7D238 | 16-164 | LSPTMPFISSSDACMTIVRNLMCHRKGGESEEFSKLAIESLIRKLKDRREELDSLILAITSSGSTPTGCVTIQRTLDGRMQIASRKC… |
| A0A2G8KE88 | 7-135 | MPFNVNRNTPVVKRLLGFIKDQREENRKWCEKAVKSLEKKLKRTGGIDELDKAISTQNTNTKCVTIMRSLDGRLQIHLKKGLPHVIY… |
| A0A6L5CM88 | 52-317 | None |
| A0A139WG04 | 28-210 | None |
| A0A368F6A6 | 93-175 | None |
| A0A2A4K5M7 | 9-198 | None |
| A0A7F8RBU2 | 69-247 | None |
| A0A7M5X184 | 22-186 | None |
| A0A0K0E0W2 | 15-182 | None |
| S4RG13 | 53-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.