DPCstruct | MC39094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 124 ± 9 aa |
| Standard deviation of domain lengths | 8.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14738 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812BH55 | 24-135 | AVLQKSSLNSKTKSVYVQTDYRDADVQTDPYTPEYVVHPGSQPEILTLATLSWGRGLPAGVAEVEMIERARAKREWEKTLPPLNDLN… |
| A0A1S8WI34 | 1-124 | MAAGNLLLDRCGIHYGPTYTSKYVQTDYRDSEAQTDPYSPPYVVNVGETPEVLTLATLGYKRGLPAGIHDVDMIERARERHQIEASL… |
| A0A6I8P5U0 | 153-294 | None |
| A0A1I8IQ60 | 388-519 | None |
| A0A0J7KG30 | 32-161 | None |
| A0A7M7NC68 | 156-270 | None |
| A0A7J8A7M2 | 17-135 | None |
| D7EKM5 | 116-246 | None |
| A0A4X2LCM3 | 323-439 | None |
| A0A3Q2FVX9 | 137-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.