DPCstruct | MC39091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 89 ± 7 aa |
| Standard deviation of domain lengths | 7.36 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 63.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6GPK6 | 83-164 | TVIYRIFYSINRSGNGHLTLRELKRGNLIAALQQLDEEEDINKVLRYFSYEHFYVIYCKFWELDADHDFLIDKENLIKYGNH |
| A0A1D6KTG9 | 54-135 | TVIYRIFYSINRSGNGHLTLRELKRGNLIAALQQLDEEEDINKVLRYFSYEHFYVIYCKFWELDADHDFLIDKENLIKYGNH |
| A0A3Q7VXJ0 | 95-176 | None |
| A0A267E501 | 100-181 | None |
| A0A437C6K3 | 184-279 | None |
| A0A7J8B8G0 | 87-183 | None |
| A0A1Y3B0U4 | 30-124 | None |
| A0A7R9HBG8 | 2-83 | None |
| A0A0R3Q1S1 | 12-110 | None |
| A0A665WQC9 | 217-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.