DPCstruct | MC39089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 5.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 53.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0210 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183T798 | 1-77 | MMDLVYLRERPQKRDTRLFQILLFLKSTFWRSLFGKEANELERDGLLENTFYMIERKPLVNKFTRYVYEGIDAERKN |
| A0A0D8Y0Y4 | 98-163 | MLDVINFREKGYRRETKLLGMLMFIKSFVWKNLFGKEADKLERSNDDQCTYLIIEKEPIVNTFISV |
| A0A3P7P0E7 | 10-89 | None |
| J9E4P8 | 66-136 | None |
| A0A0F8BAU1 | 220-291 | None |
| A0A811K659 | 316-396 | None |
| A7TA84 | 31-104 | None |
| A0A094ZNT8 | 690-766 | None |
| A0A816EW31 | 3-84 | None |
| A0A7R8ZP00 | 65-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.