DPCstruct | MC39081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Standard deviation of domain lengths | 7.88 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06792 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S4DU06 | 43-135 | SSFKVEVTIVDVSTSHQIGIDSLDDFFFVSREEVLSCYNLTGNDLPDDRGKAISIMSKALESYLSKAKEDGIIAGVIGLGGSGGTSL… |
| A0A103XKG2 | 43-136 | SKVQVIVVDVSVGLKEINSFGDFKFVSRKELFTCYSESENRLETQIPDARGEALAVMNKALTVYLKKAHQRGSVAGLVGLGGSGGTS… |
| A0A453RH04 | 33-123 | None |
| A0A5N6NJR6 | 41-136 | None |
| A0A445EX67 | 76-169 | None |
| A0A836DY81 | 71-159 | None |
| A0A1S3B9K4 | 83-192 | None |
| A0A5D2NBU1 | 2-79 | None |
| A0A444GC51 | 3-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.