DPCstruct | MC3908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 286 ± 48 aa |
| Standard deviation of domain lengths | 47.84 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W8FWV5 | 1-240 | MTEQEQEYIELVLQRDAMNQEANRSYIEYMIEFGDRILHLEQLKTAYGEAQNRLQYCQNRTDAHQPIRQNEMDEAVDVVMADARRHL… |
| A0A4Y8P750 | 14-304 | LSVNKNKGSFSLVAIDDQNIRQNWQIRYLYLQKELETVQSKLQKFLSVEKPQYTIWLESTFPKETAKLKDIELKINDLKQFIFEVEL… |
| A0A7Y5SXY6 | 44-332 | None |
| A0A3B9BIH3 | 13-293 | None |
| A0A254QMP3 | 6-391 | None |
| A0A521G8L6 | 2-244 | None |
| A0A0M1J781 | 191-520 | None |
| A0A2G6ENE8 | 35-252 | None |
| A0A4P5YSU6 | 2-303 | None |
| A0A077FKD7 | 13-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.