DPCstruct | MC39078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 128 ± 22 aa |
| Standard deviation of domain lengths | 21.55 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.66 |
| Pfam Score | 87.63 |
| Assigned Pfam label(s) | CL0193- PF14330- PF07287 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446CR64 | 9-144 | PPPPPRPAPDATMAEAAPSTWREPANAVTVPLIRLAWARSGDKGNTSNIGVIARKPEWLELLRSQLTPDRVAQYLAHLVRGPVARYE… |
| A0A522MH22 | 2-106 | ATALLGRLADGRSGDKGEASNVGLVARNERVYAWLRENLTAEAVRRLLPGIARGPVERYEVPNILALNFILHDSLGGGGTASLLTDA… |
| W7MMQ4 | 100-230 | None |
| R1GRK3 | 221-315 | None |
| A0A100J341 | 419-561 | None |
| A0A7J6LTW1 | 436-588 | None |
| A0A1M3T0V4 | 216-337 | None |
| A0A1J9RNI6 | 2-202 | None |
| A0A7D7VGT2 | 2-103 | None |
| A0A438NB83 | 816-960 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.