DPCstruct | MC39075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 158 ± 18 aa |
| Standard deviation of domain lengths | 18.37 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4E7E1 | 101-237 | TGIVPSDTDFDIFSDFGNLVGYDIGLVCNGFVYHTKYDRYDVIPRGSIQNTGDNLLGLVRSLANAPELADTTETGKAVFFDVLGLFF… |
| A0A4V3WKS2 | 34-202 | FPVIPGDTDYRIFANDYGKIPGLDVIFLLGGYFYHTSFDTVERLLPGSIQVRGDNLFSVIKAFTNSSKLQNALERESLGVAANESDN… |
| W2SJI5 | 10-148 | None |
| A0A453BIE7 | 2-171 | None |
| A0A673GPY3 | 3-164 | None |
| T1GBU4 | 1-143 | None |
| B4HP98 | 144-313 | None |
| A0A402EL40 | 426-553 | None |
| A0A0N4YP62 | 134-273 | None |
| A0A438CMS2 | 5-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.