DPCstruct | MC39071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 173 ± 32 aa |
| Standard deviation of domain lengths | 31.80 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 71.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.64 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF00010- PF03208 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4EQ92 | 19-183 | EHTNWLFDYGLIEDISVPDPNFSAPTSGFCWPLNASSNVGLEIDGSFGDSDSRKETGSKKRPRPELCGASSSSKACREKLRRDRLND… |
| A0A5J9U7H3 | 1-123 | MAFLLSRSRPESSAPPGTKACREKLRRDKLNERFNELCAILEPGKPPKADKVAILSDATRLLSQLRAEAQKLQKSNESLQDSIKSLK… |
| A0A6A6N443 | 13-163 | None |
| A0A6P5SBN4 | 1-150 | None |
| A0A2I0KAV8 | 1-189 | None |
| A0A287G755 | 1-147 | None |
| A0A7N0UUG4 | 1-220 | None |
| A0A1B6PFI2 | 6-175 | None |
| A0A835JC55 | 1-186 | None |
| A0A4S4EUT9 | 39-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.