DPCstruct | MC39067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 198 ± 29 aa |
| Standard deviation of domain lengths | 28.88 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 38.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07891 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6NI52 | 238-365 | NPYHELEAAYVARICLTWEALNWNYKNFHSKRASQRDFYPGCPGHIGQQFQQFQVLLQRYIENEPYEQGRRPEVYARMRLLAPKLLL… |
| A0A6A2XYW6 | 2-216 | VYVGQLCLSWEILHWQYEKAIEIWETDRYGLRTFNEVASEFQQFQVLMQRFIENESFEGPRVQNYVKNRCVLRNLLQVPVIREDSMK… |
| A0A166B4A2 | 236-473 | None |
| A0A6A2YKX7 | 319-461 | None |
| A0A7J7DRJ5 | 17-216 | None |
| A0A540LX55 | 182-409 | None |
| A0A0A8YTG7 | 57-250 | None |
| A0A287WHN8 | 1-213 | None |
| A0A396GQP1 | 15-166 | None |
| A0A2P5AAB7 | 511-715 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.