DPCstruct | MC39063
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 119 ± 18 aa |
| Standard deviation of domain lengths | 18.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W6RND6 | 1-102 | MSELNAQGTAKSTPKIIDAALEGLWEYIATQGEFGDIAIALVGTGRGRVALSRKKIAERIAQSFADASREKVFSNKLTIVIYPGDAE… |
| A0A5J4JLE1 | 25-137 | FKDNDYFLVAFSKFNEKNEANLRLAEYATCLLKFWDEVNALYNRRTVVLPLLGSGITRHKDFNASNQELLEVIIWTFKISKVKFKEP… |
| A0A7X6S347 | 31-164 | None |
| A0A412WXF4 | 136-258 | None |
| A0A4R0QHM6 | 55-195 | None |
| A0A5P9WUZ5 | 469-563 | None |
| A0A4U3MHQ7 | 570-694 | None |
| A0A1D8TRE1 | 28-160 | None |
| A0A1H5Z1C5 | 225-357 | None |
| A0A1B8WWR2 | 194-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.