DPCstruct | MC3906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 3.89 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 72.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00833 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672QLL4 | 23-84 | RLGNDFHINKRVCEEIAIIPSKPLRNKIAGYVTHLMKRIQRGPVRGISIKLQEEERERRDNY |
| A0A4Y7KCI8 | 1-68 | MTLDFNTNKKILEEVAIIPSKRLRNKVAGFSTHLMKRIQRRPVRWISLKLQEEERERRMNFVPEESSI |
| A0A023BDW8 | 108-165 | None |
| A0A507E4R4 | 155-214 | None |
| A0A813KAV5 | 144-210 | None |
| A0A564YI63 | 24-90 | None |
| A0A813FJ54 | 549-606 | None |
| A0A7J6YTC1 | 24-90 | None |
| A0A183B0W4 | 29-90 | None |
| A0A3Q0DII1 | 15-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.